PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008246237.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 133aa    MW: 14824.6 Da    PI: 8.1884
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008246237.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.41.4e-5525120297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     ++qdrflPianvsrimkk lPanakisk+aketvqecvsefisf+t+easdkc rekrktingddllwa++tlGfe+yv plk yl+kyre+ege
  XP_008246237.1  25 KDQDRFLPIANVSRIMKKSLPANAKISKEAKETVQECVSEFISFITGEASDKCLREKRKTINGDDLLWAMTTLGFENYVGPLKGYLNKYRETEGE 119
                     79********************************************************************************************9 PP

           NF-YB  97 k 97 
                     k
  XP_008246237.1 120 K 120
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.1E-5322130IPR009072Histone-fold
SuperFamilySSF471131.24E-4027129IPR009072Histone-fold
PfamPF008084.1E-273094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.5E-195876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.5E-197795No hitNo description
PRINTSPR006157.5E-1996114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MSGRRNQTSP VGSPLSGNVS DGSSKDQDRF LPIANVSRIM KKSLPANAKI SKEAKETVQE  60
CVSEFISFIT GEASDKCLRE KRKTINGDDL LWAMTTLGFE NYVGPLKGYL NKYRETEGEK  120
NSMTRQEEDP SQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-4725115292Transcription factor HapC (Eurofung)
4g92_B9e-4725115292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205885.12e-94hypothetical protein PRUPE_ppa011298mg
RefseqXP_008246237.11e-95PREDICTED: nuclear transcription factor Y subunit B-3-like, partial
SwissprotO233104e-62NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLM5W0472e-94M5W047_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s06480.13e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-63nuclear factor Y, subunit B3